PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID RrC4211_p3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family Dof
Protein Properties Length: 257aa    MW: 27888.9 Da    PI: 9.0071
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
RrC4211_p3genomeMSUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof125.12.1e-3952109562
      zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                 +l+cprCdstntkfCyynnyslsqPryfCk+C+ryWtkGG+lrn+PvGgg+rknk+s+
  RrC4211_p3  52 SLRCPRCDSTNTKFCYYNNYSLSQPRYFCKSCKRYWTKGGTLRNIPVGGGCRKNKRST 109
                 689****************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074784.0E-3046106IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.30153107IPR003851Zinc finger, Dof-type
PfamPF027018.3E-3453107IPR003851Zinc finger, Dof-type
PROSITE patternPS0136105591IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048364Biological Processroot development
GO:0005634Cellular Componentnucleus
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 257 aa     Download sequence    Send to blast
MDHLLHQQDV FGNFNKTREA MGSSSNPPHL DHEQKKPSPA TGAARPQPPE LSLRCPRCDS  60
TNTKFCYYNN YSLSQPRYFC KSCKRYWTKG GTLRNIPVGG GCRKNKRSTS SATRSLRTTP  120
EPASHDGKAF SAASFGGFGN NEHIDLSLAF ALLNKQPPGS SSQLGFPSEF GSSSHQSGME  180
SVFGTSQQKG NTGYAFGNGS SGLDMTMSDP NKVLWGFPWQ MNGEMNMGGG GGGHVDHIDS  240
GREIWTNMNY INSGALM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2347370.0AC234737.1 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrH010D15, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009126620.11e-172PREDICTED: dof zinc finger protein DOF5.3-like
SwissprotQ84TE91e-149DOF53_ARATH; Dof zinc finger protein DOF5.3
TrEMBLA0A078F7571e-173A0A078F757_BRANA; BnaA02g06470D protein
STRINGBra020261.1-P1e-159(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM61321845
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60200.11e-136TARGET OF MONOPTEROS 6